PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400019407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 407aa    MW: 45048.7 Da    PI: 9.8153
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400019407genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.69.4e-32194250360
                           -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           DgynWrKYGqK+vkgse+prsYY+Ct+ +Cpvkkkvers  d ++ ei+Y+geHnh+k
  PGSC0003DMP400019407 194 DGYNWRKYGQKQVKGSEYPRSYYKCTHLKCPVKKKVERSY-DAQIAEIVYRGEHNHPK 250
                           9***************************************.***************85 PP

2WRKY32.81.4e-10386406222
                           --SS-EEEEEEE--TT-SS-E CS
                  WRKY   2 dDgynWrKYGqKevkgsefpr 22 
                           dDg++WrKYGqK+vkgs +pr
  PGSC0003DMP400019407 386 DDGFRWRKYGQKVVKGSSYPR 406
                           8*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-29182251IPR003657WRKY domain
SuperFamilySSF1182904.05E-25191251IPR003657WRKY domain
SMARTSM007745.2E-35192250IPR003657WRKY domain
PROSITE profilePS5081124.03194251IPR003657WRKY domain
PfamPF031061.0E-24194249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-9376406IPR003657WRKY domain
PROSITE profilePS5081113.505380406IPR003657WRKY domain
SuperFamilySSF1182904.18E-8380406IPR003657WRKY domain
PfamPF031062.2E-6386406IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MEVNETAKIA IVRPVASRPR CPIYKSFSEL LAGAVDISST NARSEMAITA IRPKTVRLKP  60
VTNHALVGER SSQIGVSEAP VGCRSDYILQ SVEKPKVLYK PIAKLAPRKT IPLLENKGSS  120
VSDQRREKAE TKAGVQSANE VKQHRDLTTE SKRSLLAKSG EDKKIVGSTI VSESTEEVPQ  180
SLINTSNVDR PSYDGYNWRK YGQKQVKGSE YPRSYYKCTH LKCPVKKKVE RSYDAQIAEI  240
VYRGEHNHPK PQPPKRNLSD VHVRAAVCND TSKETNNPAW SNQHPQTSEA YVYRIENQND  300
FGLTIHSAHS SKAPCFYDPI AAAGMLTVVG NSEDSAEGSK KLETTCDEPK TKRRKLKGQC  360
NGAGTSGEST FPYIPNQSTT DSEITDDGFR WRKYGQKVVK GSSYPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-17180251874WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754490.0HG975449.1 Solanum pennellii chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339294.20.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165027.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165028.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165029.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165031.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165033.10.0PREDICTED: WRKY transcription factor 44
RefseqXP_015165034.10.0PREDICTED: WRKY transcription factor 44
TrEMBLM1AR970.0M1AR97_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000285300.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.12e-61WRKY family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]